A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10622
Swiss-prot Accession number	P53542 (Sequence in FASTA format)
Description	Glycoprotein hormones alpha chain precursor (Gonadotropin alpha chain)(GTH-alpha).
Source organism	Clarias gariepinus (Sharptooth catfish) (African catfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Siluriformes;Clariidae; Clarias.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit alpha family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Involved in gametogenesis and steroidogenesis
Protein Length	116 Amino acids
Molecular weight	13060
References	1   Rebers F.E.M., Tensen C.P., Schulz R.W., Goos H.J.T., Bogerd J.; Submitted (MAY-1996) to the EMBL/GenBank/DDBJ databases.
Domain Name	Hormone_6
Hormone Name	Glycoprotein hormones alpha chain
Mature Hormone Sequence	YPNNDFGCEECKLKENNIFSKPGAPVYQCMGCCFSRAYPTPLRSKKTMLVPKNITSEATCCVAKEVKRVIVNDVKLVNHTDCHCSTCYYHKF
Position of mature hormone in Pre-Hormone protein	92 Residues from position (25-116)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	11439
Swiss-prot Accession number	P33439 (Sequence in FASTA format)
Description	Progonadoliberin-1 precursor (Progonadoliberin I) [Contains:Gonadoliberin-1 (Gonadoliberin I) (Luteinizing hormone-releasinghormone I) (LH-RH I) (Gonadotropin-releasing hormone I) (GnRH-I)(Luliberin I); GnRH-associated peptide 1 (GnRH-associated peptide I)].
Source organism	Clarias gariepinus (Sharptooth catfish) (African catfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Siluriformes;Clariidae; Clarias.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the GnRH family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates the secretion of gonadotropins
Protein Length	80 Amino acids
Molecular weight	8893
References	1  PubMed abstract 8020492 2  PubMed abstract 1520292
Domain Name	N/A
Hormone Name	Gonadoliberin-1
Mature Hormone Sequence	QHWSHGLNPG
Position of mature hormone in Pre-Hormone protein	10 Residues from position (22-31)
Receptor	Q8JID0    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 3

HMRbase accession number	11458
Swiss-prot Accession number	P43306 (Sequence in FASTA format)
Description	Progonadoliberin-2 precursor (Progonadoliberin II) [Contains:Gonadoliberin-2 (Gonadoliberin II) (Luteinizing hormone-releasinghormone II) (LH-RH II) (Gonadotropin-releasing hormone II) (GnRH II)(Luliberin II); GnRH-associated peptide 2 (GnRH-associated peptideII)].
Source organism	Clarias gariepinus (Sharptooth catfish) (African catfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Siluriformes;Clariidae; Clarias.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the GnRH family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates the secretion of gonadotropins
Protein Length	86 Amino acids
Molecular weight	9766
References	1  PubMed abstract 8020492 2  PubMed abstract 1520292
Domain Name	N/A
Hormone Name	Gonadoliberin-2
Mature Hormone Sequence	QHWSHGWYPG
Position of mature hormone in Pre-Hormone protein	10 Residues from position (25-34)
Receptor	O42329   Detail in HMRbase    Q8JID0    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments